SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022357 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022357
Domain Number 1 Region: 231-305
Classification Level Classification E-value
Superfamily Homeodomain-like 1.63e-26
Family Homeodomain 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000022357
Domain Number - Region: 56-66
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00837
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0889
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022357   Gene: ENSPTRG00000013068   Transcript: ENSPTRT00000024236
Sequence length 348
Comment pep:novel chromosome:CHIMP2.1.4:2B:241407474:241409819:-1 gene:ENSPTRG00000013068 transcript:ENSPTRT00000024236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP
PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE
AAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAEAVQASLVGAVRG
QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGS
TTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA
KWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
Download sequence
Identical sequences A0A096N887 A0A2K5M8U4 A0A2K5RJ34 A0A2K5UYD4 A0A2K6CRE5 G1RI92 H2QJN8
XP_001082998.1.72884 XP_003277528.1.23891 XP_004033454.1.27298 XP_005574763.1.63531 XP_011726281.1.29376 XP_011899336.1.92194 XP_017393223.1.71028 XP_526072.2.37143 ENSPTRP00000022357 ENSPANP00000008813 ENSPTRP00000022357 ENSMMUP00000007770 ENSNLEP00000012948 ENSGGOP00000018628 ENSNLEP00000012948 9544.ENSMMUP00000007770 9598.ENSPTRP00000022357 ENSMMUP00000007770 ENSGGOP00000005402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]