SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022456 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022456
Domain Number 1 Region: 1004-1185
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-18
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 2 Region: 696-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000745
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 753-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000123
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 4 Region: 386-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000179
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 5 Region: 908-986
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000786
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 791-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 311-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000014
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 431-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 582-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000482
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 543-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000802
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 11 Region: 659-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000804
Family EGF-type module 0.022
Further Details:      
 
Domain Number 12 Region: 620-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000218
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 13 Region: 1310-1346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000407
Family EGF-type module 0.018
Further Details:      
 
Domain Number 14 Region: 829-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 15 Region: 351-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000984
Family EGF-type module 0.027
Further Details:      
 
Domain Number 16 Region: 272-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 17 Region: 869-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000232
Family EGF-type module 0.014
Further Details:      
 
Domain Number 18 Region: 473-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000383
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000022456
Domain Number - Region: 508-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0121
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022456   Gene: ENSPTRG00000013115   Transcript: ENSPTRT00000024341
Sequence length 1413
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:246322063:246418292:1 gene:ENSPTRG00000013115 transcript:ENSPTRT00000024341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHGVAWALLVAAALGLGARGVRGAVALADFYPFGAERGDAVTPKQDDGGSGLRPLSVPF
PFFGAEHSGLYVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYYRE
ATDPAVLRRATEDVRRYFPELLDFSATWVFVATWYRVTFFGGSSSSPVNTFQTVLITDSK
LSFTIFNYESIVWTTGTHASSGGNATGLGGIAAQAGFNAGDGQRYFSIPGSRTADMAEVE
TTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLALRPCLNGGKCIDDCVTGNPSYTCSCL
SGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCPAGFGGPTCETAQSPCDTKECQH
GGQCQVENGSAVCVCQAGYTGAACETDVDDCSPDPCLNGGSCVDLVGNYTCLCAEPFKGL
RCETGDHPVPDACLSAPCHNGGTCVDANQGYVCECPEGFMGLDCKERVPDDCECRNGGRC
LGANTTLCQCPPGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCHTDHNASHS
LPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGG
EYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSP
CFRSPCVNGGTCEDRGTDFFCHCQAGYMGRRCQAEVDCGPPEEVKHATLRFNSTRLGAVA
LYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDECRSQPCLHGGSCQDRVAGYLCLCS
TGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCPAGFVGVHCETEEDACNSSPCQH
GGRCESGGGAYLCVCPESFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGK
DCTKELFPPTALKMERVEESGVSISWNPPDGPAARQMLDGYAVTYVSSDGSYRRTDFVDR
TRSSHQLQALAAGRAYNISVFSVKRNSNNKNDISRPAVLLARTRPRPVEGFEVTNVTAST
ISVQWALHRIRHATVSGVRVSIRHPEALRDQATDVDRSVDRFTFRALLPGKRYTIQLTTL
SGLRGEEHPTESLATAPTHVWTRPLPPANLTAARVTATSAHVVWDAPTPGSLLEAYVINV
TTSQSTKSRYVPNGKLASYTVRDLLPGRRYQLSVIAVQSTELGPQHSEPAHLYIITSPRD
GTDRRWHQGGHHPRVLRNRPPPARLPELRLLNDHSAPETATQPPRFSELVDGRGRVSARF
DGSPSKAATVRSQPTASAQLENMEEAPKQVSLALQLPEHGNKDIGNVPGNCSENPCQNGG
TCVPGADAHSCDCGPGFKGRRCELACIKVSRPCTRLFSETKSFPVWEGGVCHHVYKRVYR
VHQDICFKESCESTSLKKTPNRKQSKSQTLEKS
Download sequence
Identical sequences ENSPTRP00000022456 ENSPTRP00000022456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]