SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022464 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022464
Domain Number 1 Region: 79-354
Classification Level Classification E-value
Superfamily L domain-like 2.13e-54
Family Internalin LRR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022464   Gene: ENSPTRG00000013118   Transcript: ENSPTRT00000024349
Sequence length 360
Comment pep:known chromosome:CHIMP2.1.4:2B:246482732:246517575:1 gene:ENSPTRG00000013118 transcript:ENSPTRT00000024349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE
EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKNLCLRQNLIKCIENLEELQ
SLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIE
NLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSN
RLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQE
FWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
Download sequence
Identical sequences H2QJR3
ENSPTRP00000022464 ENSPTRP00000022464 9598.ENSPTRP00000022464 XP_001158701.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]