SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022553 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022553
Domain Number 1 Region: 142-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-121
Family Transglutaminase core 0.00000000000929
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily E set domains 1.89e-42
Family Transglutaminase N-terminal domain 0.000000225
Further Details:      
 
Domain Number 3 Region: 482-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.15e-31
Family Transglutaminase, two C-terminal domains 0.000000708
Further Details:      
 
Domain Number 4 Region: 594-692
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-26
Family Transglutaminase, two C-terminal domains 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022553   Gene: ENSPTRG00000013174   Transcript: ENSPTRT00000024449
Sequence length 693
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:2173848:2219264:1 gene:ENSPTRG00000013174 transcript:ENSPTRT00000024449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGVQSINWQTAFNRQAHHTDRFSSQELILRRGQNFQVLMIMNKGLGSNERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGRYTMALQIFSQ
GGISSVKLGTFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIFVGSTNRIGMIGWNFGQ
FEEDILSICLSILDRSLNFRRDAAADVARRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRNWNGSVEILKTWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
SQGVFQCGPASVIGVREGDVQLNFDMPFIFAEVNADRITWLYNNTTGKQWKNSVNSHTIG
RYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLKPNASFGATSSMGLETEEQE
PSIIGKLKVAGMLAVGKEVSLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSAT
MSLDPEEEAEHPIKISYAQYEKYLKSDNMIRITAVCKVPDESEVVVERDVILDNPTLTLE
VLNEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLGPKERSRVRFD
ILPTRSGTKQLLADFSCNKFPAIKAMLSIDVAE
Download sequence
Identical sequences H2QJU1
ENSPTRP00000022553 9598.ENSPTRP00000022553 ENSPTRP00000022553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]