SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022554 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022554
Domain Number 1 Region: 143-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.03e-123
Family Transglutaminase core 0.00000000415
Further Details:      
 
Domain Number 2 Region: 3-141
Classification Level Classification E-value
Superfamily E set domains 3.46e-44
Family Transglutaminase N-terminal domain 0.0000739
Further Details:      
 
Domain Number 3 Region: 494-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.47e-26
Family Transglutaminase, two C-terminal domains 0.0003
Further Details:      
 
Domain Number 4 Region: 608-703
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.45e-23
Family Transglutaminase, two C-terminal domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022554   Gene: ENSPTRG00000013175   Transcript: ENSPTRT00000024450
Sequence length 706
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:2259307:2308058:1 gene:ENSPTRG00000013175 transcript:ENSPTRT00000024450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIRVTKVDWQRSRNGAAHHTQEYPCPELVVRRGQSFSLTLELSRALDCEETLIFTVET
GPRASEALHTKAVFQTSELERGEGWTAAREAQMENTLTVSLASPPSAVIGRYLLSIRLSS
HRKHSNRRLGEFVLLFNPWCAEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYG
QFQEDILDICLSILDRSPGHQNNPATDVSCRHNPIYVTRVISAMVNSNNDRGVVQGQWQG
KYGGGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDSFGRTLEDLTEDSMWNLHVWNESWFARQDIGPSYNGWQVMDATPQ
EESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKI
GRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVNRLFGVEASGRRTWIRRAGGRC
LWRDDLLEPATKPSIAGKFKVLEPPMLGHDLRLALCLANLTSRAQRVRVNLSGATILYTR
KPVAEILHESHAVRLGPQEEKRIPITISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKVLGPAMVGVAVTVEVTVVNPLIERVKDCALMAEGSGLLQEQLSIDVPTL
EPQERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIVHVATAK
Download sequence
Identical sequences ENSPTRP00000022554 9598.ENSPTRP00000022554 ENSPTRP00000022554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]