SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022609 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022609
Domain Number 1 Region: 360-641
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-46
Family Kelch motif 0.0035
Further Details:      
 
Domain Number 2 Region: 781-927
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-23
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 3 Region: 130-245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1061-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000364
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000022609
Domain Number - Region: 97-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 246-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00851
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022609   Gene: ENSPTRG00000013198   Transcript: ENSPTRT00000024513
Sequence length 1427
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:3343920:3519852:1 gene:ENSPTRG00000013198 transcript:ENSPTRT00000024513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAAAATEPRLRRTAATAALAGRSGPHWDWDVTRAGRPGLGAGLRLPRLLSPPLRPRLL
LLLLLLSPPLLLLLLPCEAEAAAAAAAVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCPA
GWVGEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECS
WDHLYVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFN
ITYSFGMCPNNCSGRGECKISNSSDTVECECSENWKGEACDIPHCTDNCGFPHRGICNSS
DVRGCSCFSDWQGPGCSVPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYMFN
HSDYNMVLAYDLASREWLPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNELR
VFHIHNESWVLLTPKAKEQYAVVGHSAHIVTLKNGRVVMLVIFGHCPLYGYISNVQEYDL
DKNTWSILHTQGALVQGGYGHSSVYDHRTRALYVHGGYKAFSANKYRLADDLYRYDVDTQ
MWTILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSV
LPRPDLHHDVNRFGHSAVLHNSTMYVFGGFNSLLLSDILVFTSEQCDGHRSEAACLAAGP
GIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHW
CNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIA
LPENICGIGWHLVGNSCLKITTAKENYDNAKLFCRNHNALLASLTTQKKVEFVLKQLRIM
QSSQSMSKLTLTPWVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTR
GLKAATCINPLNGSVCERPANHSAKQCRTPCALRTACGDCTSGSSECMWCSNMKQCVDSN
AYVASFPFGQCMEWYTMSTCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYK
GPVKMPSQAPTGNFYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCEN
LTTGKHCETCISGFYGDPTNGGKCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEV
ENRYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKN
FNLNITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTW
PIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQ
MASRPFASVNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGI
PPPGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences ENSPTRP00000022609 ENSPTRP00000022609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]