SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022652 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022652
Domain Number 1 Region: 24-328,475-524
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.67e-55
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 308-431
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.32e-31
Family L-aminoacid/polyamine oxidase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022652   Gene: ENSPTRG00000013214   Transcript: ENSPTRT00000024556
Sequence length 532
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:4003309:4042674:1 gene:ENSPTRG00000013214 transcript:ENSPTRT00000024556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNHGRRIPKDVVEEFSDLYNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRI
RNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPAHVIQLGKPVRCIHWDQASARPRGPEIEPRGVLKRQYTSFFRPGLPTEK
VAAIHRLGIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESHTLTYPPELWYRKICGFDV
LYPPERYGHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWG
SNPYFRGSYSYTQVGSSGADVEKLAKPLPYTESSKTAHGSSTKQQPGHLFSSKCPEQPLD
ANRGAVKPMQVLFSGEATHRKYYSTTHGALLSGQREAARLIEMYRDLFQQGT
Download sequence
Identical sequences A0A2J8MSH7
ENSPTRP00000022652 ENSP00000278795 NP_787036.1.87134 NP_787036.1.92137 XP_012367167.1.23891 ENSP00000278795 ENSPTRP00000022652 gi|28559080|ref|NP_787036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]