SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022764 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022764
Domain Number 1 Region: 113-459
Classification Level Classification E-value
Superfamily Subtilisin-like 1.09e-81
Family Subtilases 0.00000000865
Further Details:      
 
Domain Number 2 Region: 453-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-43
Family Proprotein convertase P-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 30-101
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 7.99e-16
Family Prohormone convertase 1 pro-domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022764   Gene: ENSPTRG00000013273   Transcript: ENSPTRT00000024670
Sequence length 638
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:17272006:17530713:1 gene:ENSPTRG00000013273 transcript:ENSPTRT00000024670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGGCVFQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDEARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILNKN
Download sequence
Identical sequences H2QJZ8
XP_001138346.1.37143 XP_003810641.1.60992 9598.ENSPTRP00000022764 ENSPTRP00000022764 ENSPTRP00000022764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]