SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022811 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022811
Domain Number 1 Region: 665-780,945-1002
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000294
Family FAD/NAD-linked reductases, N-terminal and central domains 0.039
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000022811
Domain Number - Region: 179-247
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000368
Family N-acetyl transferase, NAT 0.062
Further Details:      
 
Domain Number - Region: 463-568
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000593
Family N-acetyl transferase, NAT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022811   Gene: ENSPTRG00000013301   Transcript: ENSPTRT00000024721
Sequence length 1171
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:20155250:20445005:1 gene:ENSPTRG00000013301 transcript:ENSPTRT00000024721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLTSPRGKVEVVHCRRTESQDVYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCND
KEEIMAQATFLDYPNWNVAKQDDWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCK
EILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDFAVHMCHRHSHY
PQLHVRKARVEDHDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEVEGTAVG
FMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLESPQDLSVRRSQDAELRSSSQGSQKI
VEELQEPVSPDTMENIQGNIAREAASEEALTAVHSGNVSEPEDIEKLSDISTGYAQYHHV
SSRSLASLILPEEPVHFRPIYRGASAAFCIQLFCIDEKYEARSLDFMNFVFSLFSDKNFC
VISLPHLTPEFFLIQNFVKMVPFNTCTLEQDLYVFHRAGLLKSIDIRFATLLDTPGVENL
VSTLMLNKSILEDLDHYNKARKDPDGTPLQAFVAEVAEQIVGIAVIRNEMDIEYIRSHYN
IEDFIYFSHHQREEHGHMHHFALNPIFRHYTKFFLKEILRLGFKSCLYYRVYPKSREGKF
QNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDPMSYALNHTNRKLTLEP
KITVNAKIIVVGASSVGISFLETLVFCSHMKFNNLTLISTHGLPGKKLLDTEQRKFLASD
HCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDKIVPYDHLILCTGQQYQVPCP
TEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALTWIRNNSITTEGNIIVY
GNTIDTYTTVETLLNLGVSGSRIHLVQPPPASTITCINNYSVESAVADALGAAGVTMYRD
AILAQWNDGLHPDPIYSASFTTPTKPFRLQCSMFFSFCEKNVDYETFKALNDACLVYDSR
LVIDTNFHTNDIAIRAAGSLTKFSSRYYSNEWTHSNFSSKEVGFQLAAAMLHLFDPTLEP
VTEPPANLDRLIPMYKGAKIQGGILPGSYHYLHIAKPAIPTPLEVQMAQPNYGLELVTGS
AKNGTYFRIHINKYKMVETITCLSREPFPASNYIRLFGQHEQLLNNLCARYDENLITDLY
SYFTEPWCLALFHDRFIDLRKELRQILASKE
Download sequence
Identical sequences ENSPTRP00000022811 ENSPTRP00000022811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]