SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023150 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023150
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-122
Family Transglutaminase core 0.0000000000134
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 9.8e-44
Family Transglutaminase N-terminal domain 0.000000247
Further Details:      
 
Domain Number 3 Region: 470-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-33
Family Transglutaminase, two C-terminal domains 0.000000454
Further Details:      
 
Domain Number 4 Region: 586-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.1e-28
Family Transglutaminase, two C-terminal domains 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023150   Gene: ENSPTRG00000013483   Transcript: ENSPTRT00000025085
Sequence length 687
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:35003119:35040838:-1 gene:ENSPTRG00000013483 transcript:ENSPTRT00000025085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVDEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTSRALSTRARPKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSGGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
Download sequence
Identical sequences ENSPTRP00000023150 ENSPTRP00000023150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]