SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023219 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023219
Domain Number 1 Region: 42-222
Classification Level Classification E-value
Superfamily PR-1-like 5.23e-48
Family PR-1-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023219   Gene: ENSPTRG00000013517   Transcript: ENSPTRT00000025156
Sequence length 253
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:41303283:41317994:1 gene:ENSPTRG00000013517 transcript:ENSPTRT00000025156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLPSTVGLAGLLFWAGQAVNALIMPNATPAPAQPESTAVRLLSGLEVPRYRRKRHISV
RDMNALLDYHNHIRASVYPPAANMEYMVWDKRLARAAEAWATQCIWAHGPSQLMRYVGQN
LSIHSGQYRSVVDLMKSWSEEKRHYLFPAPRDCNPHCPWRCDGPTCSHYTQMVWASSNRL
GCAIHTCSSISVWGNTWHRAAYLVCNYAIKGNWIGESPYKMGKPCSSCPPSYQGSCNSNM
CFKGLKSNKLTWF
Download sequence
Identical sequences H2QKE2
9598.ENSPTRP00000023219 ENSPTRP00000023219 ENSPTRP00000023219 XP_525333.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]