SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023288 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023288
Domain Number 1 Region: 33-86
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000482
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023288   Gene: ENSPTRG00000013560   Transcript: ENSPTRT00000025235
Sequence length 99
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:42718593:42722096:1 gene:ENSPTRG00000013560 transcript:ENSPTRT00000025235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYN
RTSKRCETFVFSGCNGNLNNFKLKIEREVACVAKYKPPR
Download sequence
Identical sequences H2QKG5 Q6UDR6
ENSP00000279058 ENSPTRP00000023288 NP_848550.1.87134 NP_848550.1.92137 gi|110626171|ref|NP_848550.1| ENSP00000279058 9598.ENSPTRP00000023288 9606.ENSP00000279058 ENSPTRP00000023288 ENSP00000279058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]