SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023719 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023719
Domain Number 1 Region: 2-43
Classification Level Classification E-value
Superfamily HMG-box 0.000000000445
Family HMG-box 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023719   Gene: ENSPTRG00000030459   Transcript: ENSPTRT00000025691
Sequence length 264
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:61459466:61460260:-1 gene:ENSPTRG00000030459 transcript:ENSPTRT00000025691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAWKELNAAEKRPFVEEAERLRVQHLRDHPNYKYRPRRKKQARKARRLEPGLLLPGLAPP
QPPPEPFPAASGSARAFRELPPLGAEFDGLGLPTPERSPLDGLEPGEAAFFPPPAAPEDC
ALRPFRAPYAPTELSRDPGGCYGAPLAEALRTAPPAAPLAGLYYGTLGTPGPYPGPLSPP
PEAPPLESAEPLGPAADLWADVDLTEFDQYLNCSRTRPDAPGLPYHVALAKLGPRAMSCP
EESSLISALSDASSAVYYSACISG
Download sequence
Identical sequences 9598.ENSPTRP00000023719 ENSPTRP00000023719 ENSPTRP00000023719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]