SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023786 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023786
Domain Number 1 Region: 136-313
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.23e-25
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0049
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000719
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023786   Gene: ENSPTRG00000013807   Transcript: ENSPTRT00000025772
Sequence length 353
Comment pep:known_by_projection chromosome:CHIMP2.1.4:21:11773827:11795880:-1 gene:ENSPTRG00000013807 transcript:ENSPTRT00000025772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALAMGSRALRLWRVAPGGGISWRFIATSPASQLSPSELTEMRNDLFNKEKARQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDRDPGEVNKAYWRSCAMMMGYVIERAFKDEYMVNLVRAPEVPVISGAFC
YDVVLDSKLDEWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHSKYKIDFI
EEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGV
SLPVHLRAHFTIWDKLLERSRKMTPFPILFLFTTQSFFTTSPESYLLHGTVSE
Download sequence
Identical sequences H2QKV7
XP_009445240.1.37143 ENSPTRP00000023786 9598.ENSPTRP00000023786 ENSPTRP00000023786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]