SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023980 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023980
Domain Number 1 Region: 314-400,821-905
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000243
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 2 Region: 112-157
Classification Level Classification E-value
Superfamily Elafin-like 0.00000144
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 3 Region: 500-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000387
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 261-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000806
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000023980
Domain Number - Region: 1017-1056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000234
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 390-474
Classification Level Classification E-value
Superfamily SEA domain 0.000288
Family SEA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023980   Gene: ENSPTRG00000013936   Transcript: ENSPTRT00000025992
Sequence length 1445
Comment pep:known_by_projection chromosome:CHIMP2.1.4:21:28142853:28215055:1 gene:ENSPTRG00000013936 transcript:ENSPTRT00000025992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRTSGLALLALVSAVGPSQASGFTEKGLSLLGYQLCSHRVTHTVQKVEAVQTSYTSYVS
CGGWIPWRRCPKMVYRTQYLVVEVPESRNMTDCCEGYEQLGLYCVLPLNQSRQFTSRPGV
CPAEGPEPSTSPCSLDTDCPGLEKCCPWSGGRCCMAPAPQAPERDPVGSWYNVTILVKMD
FKELQQVDPRLLNHMRLLHSLVTSALQSMASTVHHLHSAPGDASTTVSRLLLGLPRPLPV
ANVSTLLGAIAKRVYEVISVQVQDVNECFYEELNACSGRELCANLEGSYRCVCHQEAPAT
SPRKLNLEWEDCPPVSDYVVLNVTSDSFQVSWHLNSTQNHTFHVRVYRGMELLRSARTQS
QALAVAGLEAGVLYRVKTSYQGCGADVSTTLTVKTNAQVFEVTIKIVNHNLTEKLLNRSS
VEYQDFSRQLLHEVESSFPPAVSDLYRSGKLRMQIVSLQAGSVVVRLKLTVQDPGFPMGI
STLAPLLQPLLASTVFQIDWQGTRVQDWDECVDSAEHDCSPAAWCINLEGSYTCQCRTTR
DATPSRAGRACEGDLVSPTGGGLSAATGVTVPGLGTGTAAPGLENFTLSPSRGHPQGTPA
AGQAWTPEPSPRRGGSSVVVYDRNNTGKGVEQEVPSTAPGLGMDQGSPSQVNPSQGRLRQ
ESTSQASPSQRSTSQGSTSHANSSQGSPSQESPSQGSPSHANSSQGSTSQGSPSQESPSQ
ASPSHRNTIGVIGTTSSPKAPGSTHSFPPGATDGPLALPGQLGNSTMEPPSWPSRTEDPT
GHVMWHATRSTRETLLNPTWLRNEDSGLSGSVDLPLTSTLTALKTPACVPVSIGRIMVSN
VTSTGFHLAWEADLAMDSTFQLTLTSTWSPAVVLETWNTSVTLSGLEPGVLHLVEIMAKA
CGKEGARAHLKVRTAARKLIGKVRIKNVRYSESFRNASSQECRDFLELFFRTVRGSLPAT
MCQHMDAGGVRMEVIGVTNGSVVVEFHLLIIADVDVQEVSAAFLTAFQTAPLLEVIRGDT
FIQDYDECERKEDDCVPGTSCRNTLGSFTCSCEGGAPDFPVEYSERPCEGDSPGNETWAT
SPERPLTTAGTKAAFVQGTSPTPQGLPQRLNLTAAVRVLCEIEKVVVAIQKRFLQQESIP
ESSLYLSHPSCNVSHSNGTHVLLEAGWSECGTLMQSNMTNTVVRTTLRNDLSQEGIIHHL
KILSPINCAFQNDLLTSSGFTLEWGVYAIIEDLHGAGNFVTEMQLFIGDSPIPQNYSVSA
SDDVRIEVGLYRQKSNLKVVLTECWATPSSNARDPVTFSFINNSCPVPNTYTNMIENGNS
NKAQFKLRVFSFINNSIVYLHCKLRICMESPGATCKINCNNFRLLQNSETSATHQMSWGP
LIRSEGEPPHAEAGLGAGYVVLIVVAIFVLVAGTATLLIMRYQRMNGRYNFKIQSNNFSY
QVFYE
Download sequence
Identical sequences ENSPTRP00000023980 ENSPTRP00000023980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]