SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024055 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024055
Domain Number 1 Region: 15-129
Classification Level Classification E-value
Superfamily L domain-like 7.48e-27
Family Internalin LRR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024055   Gene: ENSPTRG00000013976   Transcript: ENSPTRT00000026079
Sequence length 376
Comment pep:known_by_projection chromosome:CHIMP2.1.4:21:30326300:30336491:-1 gene:ENSPTRG00000013976 transcript:ENSPTRT00000026079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICREMPSLEVITLSVNSISTLEPVSR
CQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQK
LDNQAVTEEELSRALSEGEEITAAPEREGTGHGGPKLCCTLSSLSSAAETGRDLLDSEEE
ATGAQDERGLKPPSRGQFPSLSARDASSSHRGRVSGGPLGAAAASAHCTHCTETVGREHG
ASQGPVGREHGASQGLEELCPRGSCVCRSVNAHTRVTRAPHGAILAPQPLLLSWSVECGP
RPCWAEGNRSHVEEAPHTRPQAGLLLCSDSPSVPNILTAILLLLRELDAEGLEAVQQTVG
SRLQALRGEEVQEHAE
Download sequence
Identical sequences H2QL44
ENSPTRP00000024055 ENSPTRP00000024055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]