SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024306 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024306
Domain Number 1 Region: 3-150
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000129
Family YdjC-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024306   Gene: ENSPTRG00000014115   Transcript: ENSPTRT00000026371
Sequence length 174
Comment pep:known_by_projection chromosome:CHIMP2.1.4:22:20152344:20153421:-1 gene:ENSPTRG00000014115 transcript:ENSPTRT00000026371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQAYGVRFTRLPLERGVGGCTWLEAPARAFACAVERDARAAVGPFSRHGLRWTDAFVGL
STCGRHMSAHRVSGALARVLEGTLAGHTLTAELMAHPGYPSVPPTGGCGEGPDAFSCSWE
RLHELRVLTAPTLRAQLAQDGVQLCALDDLDSKRPGEEVPCEATLEPFLEPSLL
Download sequence
Identical sequences ENSPTRP00000024306 ENSPTRP00000024306 9598.ENSPTRP00000024306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]