SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024321 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024321
Domain Number 1 Region: 21-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-26
Family V set domains (antibody variable domain-like) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024321   Gene: ENSPTRG00000014125   Transcript: ENSPTRT00000026386
Sequence length 145
Comment pep:known_by_projection chromosome:CHIMP2.1.4:22:20745894:20746620:1 gene:ENSPTRG00000014125 transcript:ENSPTRT00000026386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQR
PGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGAR
SSEKKEREREWEEEMEPIAAGTRVP
Download sequence
Identical sequences A0A2J8IUF6
9598.ENSPTRP00000024321 ENSPTRP00000024321 ENSPTRP00000024321 XP_003807782.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]