SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024604 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024604
Domain Number 1 Region: 117-301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-58
Family SPRY domain 0.000000953
Further Details:      
 
Domain Number 2 Region: 33-105
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000326
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024604   Gene: ENSPTRG00000014286   Transcript: ENSPTRT00000026692
Sequence length 348
Comment pep:known_by_projection chromosome:CHIMP2.1.4:22:31026180:31029460:1 gene:ENSPTRG00000014286 transcript:ENSPTRT00000026692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVC
FKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKLKKILQMNPRM
RKFQVDMTLDADTANNFLLISDDLRSVRSGLITQNRQDLAERFDMSICVLGSPHFTCGHH
YWEVDVGTSTEWDMGVCRESVHRKGRIQLTTERGFWTVSLRDGSRLSASTVPLTFLFVDR
KLQRVGIFLDMGMQNVSFFDAKSGSHIYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICP
LMNSGTTDAPVRPGEAKYALTPKKKQGQKITWVGRLRNFLLGKSIIQS
Download sequence
Identical sequences H2QLJ3
ENSPTRP00000024604 ENSPTRP00000024604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]