SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024687 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024687
Domain Number 1 Region: 43-221
Classification Level Classification E-value
Superfamily L domain-like 1.08e-33
Family Ngr ectodomain-like 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000024687
Domain Number - Region: 295-373
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00192
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024687   Gene: ENSPTRG00000014334   Transcript: ENSPTRT00000026784
Sequence length 791
Comment pep:known_by_projection chromosome:CHIMP2.1.4:22:36010345:36013188:-1 gene:ENSPTRG00000014334 transcript:ENSPTRT00000026784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAAALLCVCRPGAVPVDCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDLRLNENK
LKAVLYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQSSLQVLQLGYNKLSNLTEGMLRGM
SRLQFLFVQHNLIEVVTPTAFSECPSLISIDLSSNRLSRLDGATFASLASLMVCELAGNP
FNCECDLFGFLAWLVVFNNVTKNYDRLQCESPREFAGYPLLVPRPYHSLNAITVLQAKCR
NGSLPARPVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHHVTF
TSATLVVIIPHPYSKMYILVQYNNSYFSDVMTLKNKKEIVTLDKLRAHTEYTFCVTSLRN
SRRFNHTCLTFTTRDPVPGDLAPSTSTTTHYIMTILGCLFGMVIVLGAVYYCLRKRRMQE
EKQKSVNVKKTILEMRYGADVDAGSIVHAAQKLGEPPVLPVSRMASIPSMIGEKLPTAKG
LEAGLDTPKVATKGNYIEVRTGAGGDGLARPEDDLPDLENGQGSAAEISTIAKEVDKVNQ
IINNCIDALKLDSASFLGSSATGPGALERPSFLSPPYKESSHHPLQRQLSADAAVTRKTC
SVSSSGSIKSAKVFSLDVPDHPAATGLAKGDSKYIEKGSPLNSPLDRLPLVPAGSGGGSG
GGGGIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPR
HYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILD
YWKGVSAQQKL
Download sequence
Identical sequences ENSPTRP00000024687 ENSPTRP00000024687 9598.ENSPTRP00000024687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]