SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024817 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024817
Domain Number 1 Region: 41-138
Classification Level Classification E-value
Superfamily SH2 domain 4.15e-29
Family SH2 domain 0.00000449
Further Details:      
 
Domain Number 2 Region: 268-329
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-22
Family SH3-domain 0.0000346
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000109
Family SH3-domain 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000024817
Domain Number - Region: 190-227
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0811
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024817   Gene: ENSPTRG00000014404   Transcript: ENSPTRT00000026919
Sequence length 330
Comment pep:known_by_projection chromosome:CHIMP2.1.4:22:38600064:38669971:1 gene:ENSPTRG00000014404 transcript:ENSPTRT00000026919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPEWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Download sequence
Identical sequences H2QLR1
ENSPTRP00000024817 XP_001166435.2.37143 XP_001166508.1.37143 XP_016794696.1.37143 XP_016794697.1.37143 ENSPTRP00000024817 9598.ENSPTRP00000024817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]