SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025101 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025101
Domain Number 1 Region: 596-802
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-31
Family Fibronectin type III 0.00031
Further Details:      
 
Domain Number 2 Region: 805-990
Classification Level Classification E-value
Superfamily Fibronectin type III 2.24e-25
Family Fibronectin type III 0.000023
Further Details:      
 
Domain Number 3 Region: 312-404
Classification Level Classification E-value
Superfamily Immunoglobulin 2.74e-20
Family I set domains 0.00085
Further Details:      
 
Domain Number 4 Region: 420-506
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-19
Family I set domains 0.026
Further Details:      
 
Domain Number 5 Region: 225-318
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-17
Family I set domains 0.0016
Further Details:      
 
Domain Number 6 Region: 502-603
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-17
Family I set domains 0.046
Further Details:      
 
Domain Number 7 Region: 123-207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000627
Family I set domains 0.00042
Further Details:      
 
Domain Number 8 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000137
Family I set domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025101   Gene: ENSPTRG00000014560   Transcript: ENSPTRT00000027227
Sequence length 1028
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:1125987:1448501:1 gene:ENSPTRG00000014560 transcript:ENSPTRT00000027227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLWKLVILLPLINSSAGDGLLSRPIFTQEPHDVIFPLDLSKSEVVLNCAANGYPSPRY
RWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQFAY
IEDFETKTRSTVSVREGQGVVLLCGPPPHFGDLSYAWTFNDNPLYVQEDNRRFVSQETGN
LYIAKVEPSDVGNYTCFITNKEAQRSVQGPPTPLVQRTDGVMGEYEPKIEVRFPETIQAA
KDSSVKLECFALGNPVPDISWRRLDGSPLPGKVKYSKSQAILEIPNFQQEDEGFYECIAS
NLRGRNLAKGQLIFYAPPEWEQKIQNTYLSIYDNLLWECKASGKPNPWYTWLKNGERLNP
EERIQIENGTLIITMLNVSDSGVYQCAAENKYQIIYANAELRVLASAPDFSKSPVKKKSF
VQVGGDIVIGCKPNGFPRAAISWKRGTETLRQSKRVFLLEDGSLKIYNITRSDAGSYTCI
ATNQFGTAKNTGSLIVKERTVITVPPSKMDVTVGESIVLPCQVSHDPSIEVVFVWFFNGD
VIDLKKGVAHFERIGGESVGDLMIRNIQLHHSGKYLCTVQTTLESLSAVADIIVRGPPGP
PEDVQVEDISSTTSQLSWRAGPDNNSPIQIFTIQTRTPFSVGWQAVATVPEILNGKTYNA
TVVGLSPWVEYEFRVVAGNSIGIGEPSEPSELLRTKASVPVVAPVNIHGGGGSRSELVIT
WESIPEELQNGEGFGYIIMFRPVGSTTWSKEKVSSVESSRFVYRNESIIPLSPFEVKVGV
YNNEGEGSLSTVTIVYSGEDEPQLAPRGTSLQSFSASEMEVSWNAIAWNRNTGRVLGYEV
LYWTDDSKESMIGKIRVSGNVTTKNITGLKANTIYFASVRAYNTAGTGPSSPPVNVTTKK
SPPSQPPANIAWKLTNSKLCLNWEHVKTMENESEVLGYKILYRQNRQSKTHILETNNTSA
ELLVPFEEDYLIEIRTVSDGGDGSSSEEIRIPKMSSLSSRGIQCLEPSTHFLSIVIVIFY
CFAIQPLI
Download sequence
Identical sequences A0A2I3S9Z7
ENSPTRP00000025101 9598.ENSPTRP00000025101 XP_009443033.1.37143 XP_516244.2.37143 ENSPTRP00000025101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]