SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025399 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025399
Domain Number 1 Region: 32-361
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.47e-106
Family Glycosyl hydrolases family 35 catalytic domain 0.0000796
Further Details:      
 
Domain Number 2 Region: 476-517,544-649
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.39e-38
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025399   Gene: ENSPTRG00000014726   Transcript: ENSPTRT00000027543
Sequence length 677
Comment pep:known chromosome:CHIMP2.1.4:3:33541241:33648256:-1 gene:ENSPTRG00000014726 transcript:ENSPTRT00000027543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFLVRILPLLLALLLLGPTRALRNATQRMFEIDYSRDCFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVIL
RPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPV
ITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTV
DFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARG
ASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKV
PEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT
TLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNSVITLNITGKAGATLDLLVENM
GRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHCDSGHHDEAWA
HNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLT
LFVPQHILMTSAPNTITVLELERAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKR
LMPPPPQKNKDSWLDHV
Download sequence
Identical sequences A0A2I3RNR1
ENSPTRP00000025399 XP_003950098.1.37143 ENSPTRP00000025399 9598.ENSPTRP00000025399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]