SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025500 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025500
Domain Number 1 Region: 21-145
Classification Level Classification E-value
Superfamily Lysozyme-like 4.02e-38
Family C-type lysozyme 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025500   Gene: ENSPTRG00000014792   Transcript: ENSPTRT00000027653
Sequence length 146
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:43054835:43068311:-1 gene:ENSPTRG00000014792 transcript:ENSPTRT00000027653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPM
AIYENTRDGYTGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEG
MGAWPTWSRYCQYSDTLARWLDGCKL
Download sequence
Identical sequences H2QMD2
XP_003826104.1.60992 XP_008949732.1.60992 XP_008949733.1.60992 XP_008949734.1.60992 XP_016796326.1.37143 XP_016796328.1.37143 XP_016796329.1.37143 ENSPTRP00000025500 9598.ENSPTRP00000025500 ENSPTRP00000025500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]