SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025565 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025565
Domain Number 1 Region: 144-455
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.14e-116
Family Transglutaminase core 0.0000000515
Further Details:      
 
Domain Number 2 Region: 4-143
Classification Level Classification E-value
Superfamily E set domains 8.05e-41
Family Transglutaminase N-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 584-682
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.36e-23
Family Transglutaminase, two C-terminal domains 0.0011
Further Details:      
 
Domain Number 4 Region: 472-578
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000602
Family Transglutaminase, two C-terminal domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025565   Gene: ENSPTRG00000014827   Transcript: ENSPTRT00000027722
Sequence length 683
Comment pep:known chromosome:CHIMP2.1.4:3:45549697:45590210:1 gene:ENSPTRG00000014827 transcript:ENSPTRT00000027722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASKELQVLHVDFLKQDNAVSHHTWEFQTSTPVFRRGQVFHLRLVLNQPLQSYHQLKLE
FSTGPNPSIAKHTVVVLDLRTPSDHYNWQATLQNESGKEVTVAVTSSPNAILGKYQLNVK
TGNHILKSEENILYLLFNPWCKEDMVFMPDEDERKEYILNDTGCHYVGAARSIRYKPWNF
GQFEKNVLDCCISLLTESSLKPTDRRDPVLVCRAMCAMMSFEKGQGVLIGNWTGDYEGGT
APYKWTGSAPILQQYYNTKQAVCFGQCWVFAGILTTVLRALGIPARSVTGFDSAHDTERN
LTVDTYVNENGEKITNMTHDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQGVF
CCGPSPLTAIRKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHVISMETTSIGKNI
STKAVGQDRRRDITYEYKYPEGSSEERQVMDHAFLLLSSEREHRRPVKENFLHMSVQSDD
VLLGNPVNFTVILKRKTAALQNVNILGSFELQLYTGKKVAKLCDLNKTSQIQGQVSEVTL
TLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMASEVFTSFQYPEFSIELPNTGRIGQ
LLVCNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHGTVQPGETIQSQIKCTPIKTGPKK
FIVKLSSKQVKEINAQKIVLITK
Download sequence
Identical sequences ENSPTRP00000025565 ENSPTRP00000025565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]