SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025610 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025610
Domain Number 1 Region: 112-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family Cripto EGF-like domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 78-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000454
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025610   Gene: ENSPTRG00000014854   Transcript: ENSPTRT00000027768
Sequence length 188
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:47269365:47274229:1 gene:ENSPTRG00000014854 transcript:ENSPTRT00000027768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCRKMARFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIWPQEEPAIR
PRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPH
DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPLSARTTTFMLVGI
CLSIQSYY
Download sequence
Identical sequences H2QMG9
ENSPTRP00000025610 ENSPTRP00000025610 9598.ENSPTRP00000025610 XP_001151101.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]