SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025674 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025674
Domain Number 1 Region: 107-252,294-316,343-408
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 3.37e-17
Family Methylamine dehydrogenase, H-chain 0.088
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000301
Family F-box domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025674   Gene: ENSPTRG00000014883   Transcript: ENSPTRT00000027837
Sequence length 463
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:49117339:49142134:1 gene:ENSPTRG00000014883 transcript:ENSPTRT00000027837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIRLPDLALKRIFSFLDLFGLLVSQVNKHWNRIADSDYLWRSLSLQRWDCSNFTNQHLG
THTWKQFFLHQRRKELRLALAQPHNFICKVTKNIAFETELAYLSGNRLTVDEQEKSIICS
VSPKQELCAWDVQEDTMIWSSPVQEFHFSNLVTLPQMHLAITMDRKKTIKVWNCQDRDAL
AVLPMPQPCYCMEAYLTKDGPFLMVGDAAGDIYTFTLPGLRDVSKVTAFQYGIVLLHCSP
DKKWVFACGTYSRTLPQVFLTESLLRPSEGSVPLSTFLPHKLCASACWTPKVKNRITLMS
QSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYMIVFTSGP
YLLLFSITGFLLQRFEDHQAAINNFWVDPCYVLTTSENSVHVYMWEEGGRHPYLRSCCHL
ENTWHDHTTDSCISSVMCDNASIVLRVRKVSDSSILVMYSLNT
Download sequence
Identical sequences A0A2I3TCR4
ENSPTRP00000025674 ENSPTRP00000025674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]