SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025746 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025746
Domain Number 1 Region: 302-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 2 Region: 941-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000137
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 3 Region: 738-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 4 Region: 786-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 5 Region: 893-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 6 Region: 832-884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 7 Region: 477-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 425-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 9 Region: 238-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 10 Region: 993-1047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000022
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 11 Region: 390-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 12 Region: 1098-1146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 13 Region: 1050-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025746   Gene: ENSPTRG00000014912   Transcript: ENSPTRT00000027916
Sequence length 1753
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:49886069:49898098:-1 gene:ENSPTRG00000014912 transcript:ENSPTRT00000027916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
TAWWQSENGIPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTESELDPRREIRVKWYAIYEFVRGNCFW
YGHASECAPAPGAPAHAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWHPAEDGHSHACR
KCECHGHTHSCHFDMAVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPA
VCRSCDCDPMGSQDGGRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPL
GCRRCQCNARGTVPGSTPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCD
VGGALDPQCDEGTGQCHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERL
VTPGETPSWTGSGFVRLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRP
GPVPAHSLCGHLVPKDDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLIRTGGSAQPE
TPYSGPGLLIDSLVLLPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEAC
APLFISLSTLIYNGALPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGP
TGCQACQCSHEGALSSLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADE
CNTHTGACLGCRDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHR
DEYSQQIVCHCRAGYTGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTG
QCLRCLHHTEGPHCAHCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQC
PCLPNVQGPSCDRCAPNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTC
SECQELHWGDPGLQCRACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFP
ACHPCHACFGDWDRVVQDLAARTRRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIV
GARNTSAASTAQLVEATEELRREIEEATEHLTQLEAELTDVQDENFNANHALSGLERDTL
ALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASAR
HRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGG
AGCRDEDGQPRCGGLSCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQAS
EAQQRAQAALDKANASRGQVEQANQELRELIQSVKDFLNQEGADPDSIEMVATRVLELSI
PASAEQIQHLAGAIAERVRSLADVDAILARTVGDVRRAEQLLQDARRARSWAEDEKQKAE
TVQAALEEAQRAQGIAQGAIRGAVADTRDTEQTLYQVQERMAGAEQALSSAGERARQLDA
LLEALKLKRAGNSLAASTAEEMAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVL
AAQARAEQLRDEARDLLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQ
AINLQVQIYNTCQ
Download sequence
Identical sequences ENSPTRP00000025746 ENSPTRP00000025746 9598.ENSPTRP00000025746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]