SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025815 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025815
Domain Number 1 Region: 31-350
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.26e-124
Family Bee venom hyaluronidase 0.0000149
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000025815
Domain Number - Region: 413-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00165
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025815   Gene: ENSPTRG00000014956   Transcript: ENSPTRT00000027989
Sequence length 435
Comment pep:known chromosome:CHIMP2.1.4:3:51095301:51098982:-1 gene:ENSPTRG00000014956 transcript:ENSPTRT00000027989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVA
NPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAP
DFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAAR
AWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSR
ALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPL
DELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQ
ALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLQGALSLEDQAQMAVEFKCRC
YPGWQGPWCEQKSMW
Download sequence
Identical sequences H2QMN7
9598.ENSPTRP00000025815 ENSPTRP00000025815 ENSPTRP00000025815 XP_003818871.1.60992 XP_009443813.1.37143 XP_014199719.1.60992 XP_516477.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]