SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026153 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026153
Domain Number 1 Region: 291-450
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000294
Further Details:      
 
Domain Number 2 Region: 78-187
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 191-288
Classification Level Classification E-value
Superfamily LCCL domain 4.18e-24
Family LCCL domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026153   Gene: ENSPTRG00000015154   Transcript: ENSPTRT00000028340
Sequence length 775
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:101933067:102034810:-1 gene:ENSPTRG00000015154 transcript:ENSPTRT00000028340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLL
LEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDI
EDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGF
LASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAG
VHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMES
GVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNREKK
ITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNF
LPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPK
IAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMV
LTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSS
EVNHLSPRELTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQ
EVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLS
RTDSCSSAQAQYDTPKAGKPGPPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL
Download sequence
Identical sequences ENSPTRP00000026153 ENSPTRP00000026153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]