SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026167 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026167
Domain Number 1 Region: 444-740
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000011
Family Rhodopsin-like 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000026167
Domain Number - Region: 50-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family Integrin beta EGF-like domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026167   Gene: ENSPTRG00000015164   Transcript: ENSPTRT00000028355
Sequence length 797
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:103754977:103854172:1 gene:ENSPTRG00000015164 transcript:ENSPTRT00000028355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCRAWNLRVLVAVVCGLLTGIILGLGIWRIVIRIQRGKSTSSSSTPTEFCRNGGTWEN
GRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRL
CSLSLYGEIELQKVTIGNCNENLETLEKQVKDVTAPLNNISSEVQILTSDANKLTAENIT
SATRVVGQIFNTSRNASPEAKKVAIVTVSQLLDASEDAFQRVAATANDDALTTLIEQMET
YSLSLGNQSVVEPNIAIQSANFSSENAVGPSNVRFSVQKGASSSLVSSSTFIHTNVDGLN
PDAQTELQVLLNMTKNYTKTCGFVVYQNDKLFQSKTFTAKSDFSQKIISSKTDENEQDQS
ASVDMVFSPKYNQKEFQLYSYACVYWNLSAKDWDTYGCQKDKGTDGFLRCRCNHTTNFAV
LMTFKKDYQYPKSLDILSNVGCALSITGLALTVIFQIVTRKVRKTSVTWVLVNLCISMLI
FNLLFVFGIENSNKNLQTSDGDINNIDFDNNDIPRTDTINIPNPMCTAIAALLHYFLLVT
FTWNALSAAQLYYLLIRTMKPLPRHFILFISLIGWGVPAIVVAITVGVIYSQNGNNPQWE
LDYRQEKICWLAIPEPNGVIKSPLLWSFIVPVTIILISNVVMFITISIKVLWKNNQNLTS
TKKVSSMKKIVSTLSVAVVFGITWILAYLMLVNDDSIRIVFSYIFCLFNTTQGLQIFILY
TVRTKIFQSEASKVLMLLSSIGRRKSLPSVTRPRLRVKMYNFLRSLPTLHERFRLLETSP
STEEITLSESDNAKESI
Download sequence
Identical sequences A0A2I3RTE0
ENSPTRP00000026167 9598.ENSPTRP00000026167 ENSPTRP00000026167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]