SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026174 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026174
Domain Number 1 Region: 897-1009
Classification Level Classification E-value
Superfamily SEA domain 7.06e-18
Family SEA domain 0.0086
Further Details:      
 
Domain Number 2 Region: 244-338
Classification Level Classification E-value
Superfamily SEA domain 0.000000000157
Family SEA domain 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000026174
Domain Number - Region: 1057-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026174   Gene: ENSPTRG00000015167   Transcript: ENSPTRT00000028362
Sequence length 1241
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:104407559:104501388:-1 gene:ENSPTRG00000015167 transcript:ENSPTRT00000028362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPLFGKISLGILIFVLIEGDFPSLTAQTYLSIEEIQEPKSAVSFLLPEESTDLSLAT
KKKQPLDRRETERQWLIRRRRSILFPNGVKICPDESVAEAVANHVKYFKVRVCQEAVWEA
FRTFWDRLPGREEYHYWMNLCEDGVTSIFEMGTNFSESVEHRSLIMKKLTYAKETISSSE
LSSPVPVGDTSTLGDTTLSVPHPGVDAYEGASESSLERPEESISNEIENVIEEATKPAGE
QIAEFSIHLLGKQYREELQDSSSFHHQHLEEEFISEVENAFTGLPGYKEIRVLEFRSPKE
NDSGVDVYYAVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTVVYTISNFRDYIAE
TLQQNFLLGNSSLNPDPDSLQLINVRGVLRHQTEDLVWNTQSSSLQATLSSILDNTFQAA
WPSADESITSSIPPLDFSSGPPSATGRELWSESPLGDLVSTHKLAFPSKMGLSSSPEVLE
VSSLTLHSVTPAVLQTGLPVASEERTSGSHLVEDGLANVEESEDFLSIDSLPSSSFTQPV
PKETIPSMEDSDVSLTSSPYLTSSIPFGLDSLTSKVKDQLKVSPFLPDASMEKELIFDSG
LGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAKIEDKKLVLVDKMDSTDQ
ISKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTAAESASLTLPKHISEVPGVDDYSVTKA
PLILTSVAISASTDKSDQADAILREDMEQITESSNYEWFDSEVSMVKPDMQTLWTILPES
ERVWTRTSSLEKLSRDILASTPQSADRLWLSVTQSTKLPPTTISTLLEDEVIMGVQDISL
ELDRIGTDYYQPEQVQEQNGKVGSYVEMSTSVHSTEMVSVAWPTEGGDDLSYTQTSGALV
VFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNLEILNFRNGSIV
VNSRMKFANSVPPNVNNAVYMILEDFCTTAYNTMNLAIDKYSLDVESGDEANPCKFQACN
EFSECLVNPWSGEAKCRCFPGYLSVEERPCQSLCDLQPDFCLNDGKCDIMPGHGAICRCR
VGENWWYRGKHCEEFVSEPVIIGITIASVVGLLVIFSAIIYFFIRTLQAHHDRSERESPF
SGSSRQPDSLSSIENAVKYNPVYESHRAGCEKYEGPYPQHPFYSSASGDVIGGLSREEIR
QMYESSELSREEIQERMRVLELYANDPEFAAFVREQQVEEV
Download sequence
Identical sequences ENSPTRP00000026174 ENSPTRP00000026174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]