SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026244 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026244
Domain Number 1 Region: 475-713
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.62e-81
Family Eukaryotic proteases 0.0000627
Further Details:      
 
Domain Number 2 Region: 1-120
Classification Level Classification E-value
Superfamily SEA domain 6.54e-20
Family SEA domain 0.0069
Further Details:      
 
Domain Number 3 Region: 120-233
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000327
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 4 Region: 248-349
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000209
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 5 Region: 355-392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 432-471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 391-427
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000314
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026244   Gene: ENSPTRG00000015212   Transcript: ENSPTRT00000028436
Sequence length 717
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:115357999:115397224:1 gene:ENSPTRG00000015212 transcript:ENSPTRT00000028436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRITNIEFLPEYRQKESREFLSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSNNKGGL
LVHFWIVFVMPRAKGHIFCEDCVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNDKG
CSQYFYAEHLSLHYPLEISAASGRLMCHFKLVAIVGYLIRLSIKSIQIEADNCVTDSLTI
YDSLLPIRSSILYRICEPTRTLMSFVSTNNLMLVTFKSPHIRRLSGIRAYFEVIPEQKCE
NTVLVKDITGFEGKISSPYYPSYYPPKCKCTWKFQTSLSTLGIALKFYNYSITKKSMKGC
EHGWWEINGHMYCGSYMDHQTIFRVPSPLVHIQLQCSSRLSDKPLLVEYGSYNISQPCPV
GSFRCSSGLCVPQAQRCDGVNDCFDESDELFCVSPQPACNTSSFRQHGPLICDGFRDCEN
GRDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCDGTVDCPDGSDEEGCTCSRSSSALHRI
IGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMY
VQGNAKFVSPVRRIVVHEYYNSQTFDYDIALLQLSVAWPETLKQLIQPICIPPTGQRVRS
GEKCWVTGWGRRHEADNKGSLVLQQAEVELIDQTLCVSTYGIITSRMLCAGIMSGKRDAC
KGDSGGPLSCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences H2QN36
XP_003309975.1.37143 ENSPTRP00000026244 ENSPTRP00000026244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]