SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026246 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000026246
Domain Number - Region: 126-181
Classification Level Classification E-value
Superfamily SEA domain 0.00615
Family SEA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026246   Gene: ENSPTRG00000015213   Transcript: ENSPTRT00000028438
Sequence length 217
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:115402380:115434274:1 gene:ENSPTRG00000015213 transcript:ENSPTRT00000028438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLAQPSQPVDELELSVLERQPEENTPLNGANKVFPSLDEEAPPAEANKESPWSSCNKNV
VGRCKLWMIITSIFLGLIIVIIIGLCLAAVTYVDEDENEILELSSNKTFFVMLKIPEECV
AEEELPHLLTERLTDVYSTSPSLSRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKY
MMSEELVLGILLQDFHDQNIPGCESLGLDPTSLLLYE
Download sequence
Identical sequences H2QN37
XP_001154447.1.37143 9598.ENSPTRP00000026246 ENSPTRP00000026246 ENSPTRP00000026246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]