SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026334 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026334
Domain Number 1 Region: 569-614
Classification Level Classification E-value
Superfamily F-box domain 0.00000107
Family F-box domain 0.01
Further Details:      
 
Domain Number 2 Region: 35-97
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000719
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026334   Gene: ENSPTRG00000015278   Transcript: ENSPTRT00000028534
Sequence length 709
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:124962856:125000902:1 gene:ENSPTRG00000015278 transcript:ENSPTRT00000028534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKARRSPPGHHRHCEGCFNRHCHIPVEPNTSCLVISCHLLCGATFHMCKEAEHQLLCPL
EQVPCLNSEYGCPLSMSRHKLAKHLQVCPASVVCCSMEWNRWPNVDSETTLHENIMKETP
SEECLDTALALRDQKVLFRSLKMVELFPETREATEEEPTMNGETSVEEMGGAVGGVDIGL
VPHGLSATNGEMAELSQEEREVLAKTKEGMDLVKFGQWENIFSKEHAASALTNSSVSCES
KNKNDSEKEQISSGHNMVEGEGTPKKKEPQENQKQQDVRTAMETTGLAPWQDGVLERLKT
AVDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGKLEAQEVKTVYTFKVPVSYCGKR
ARLGDAMLSCKPSEHKAVDTSDLGITVEDLPKSDLIKTTLQCALERELKGHVISESRSID
GLFMDFATQTYNFEPEQFSSGTVLADLTAATPGGLHVELHSECVTRRHNKSSSAFTFTCN
KFFRRDEFPLHFKNVHTDIQSCLNGWFQHRCPLAYLGCTFVQNHFRPPGQKAKVIYSQEL
KTFAIKPEVAPELSEGRKNNHLLGHGGKSQNSLTSLPLEILKYIAGFLDSVSLAQLSQVS
VLMRNICATLLQERGMVLLQWKKKRYSHGGTSWRVHREIWQFSSLFSKIKSWEFNEVTSM
SEHLKSCPFNIVEHKTDPILLTSMCQPREQARESLVSTFRVRPRGRYVS
Download sequence
Identical sequences H2QN70
XP_009444535.1.37143 XP_016797222.1.37143 XP_016797223.1.37143 ENSPTRP00000026334 9598.ENSPTRP00000026334 ENSPTRP00000026334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]