SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026395 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026395
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000118
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026395   Gene: ENSPTRG00000015326   Transcript: ENSPTRT00000028595
Sequence length 212
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:127375833:127387393:-1 gene:ENSPTRG00000015326 transcript:ENSPTRT00000028595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVA
LCNWAELTPELLKILHSQVAGRLIICAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHV
SRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE
Download sequence
Identical sequences H2QN90
ENSPTRP00000026395 ENSPTRP00000026395 XP_001168868.1.37143 XP_003825262.1.60992 XP_009444596.1.37143 9598.ENSPTRP00000026395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]