SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026403 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026403
Domain Number 1 Region: 1025-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000401
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 986-1034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000026403
Domain Number - Region: 1150-1242
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000377
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026403   Gene: ENSPTRG00000015315   Transcript: ENSPTRT00000028605
Sequence length 1381
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:128377800:128463512:-1 gene:ENSPTRG00000015315 transcript:ENSPTRT00000028605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRASRWPPPLLLLLLPLLLLPPAAPGTRDPPPSPARRAPSLAPLAGAGLELQLERRP
EREPPPTPPRERRGPATPGPSYRAPEPGAATQRGPSGRAPRGGSADAAWKHWPESNTEAH
VENITFYQNQEDFSTVSSKEGVMVQTSGKSHAASDAPENLTLLAETADARGRSGSSSRTN
FTILPVGYSLEIATALTSQSGNLASESLHLPSSSSEFDERIAAFQTKSGTASEMGTERAM
GLSEEGTVHSQEATTSAWSPSFLPALEMGELTTPSRKRNSSGPDLSWLHFYRTAASSPLL
DLSSSSESTEKLNNSTGLQSSSVSQTKTMHVATVFTDGGPRTLRSLTVSLGPVSKTEGFP
KDSRIATTSASVLLSPSAVESRRNSRVTGNPGDEEFIEPSTENEFGLTSLRWQNDSPTFR
EHQLASSSEVQNGSPMSQTETVSRSVAPMRGGEITAHWLLTNSTTSADVTGSSASYPEGV
NASVLTQFSDSTVQSGGSHTALGDRSYSESSSTSSSESLNSSAPRGERSITGISYGQVRG
TAIEQRTSSDHTDHTYLSSTFTKGERALLSITDNSSSSDIVESSTSYIKISNSSHSEYSS
FFHAQTERSNISSYDGEYAQPSTESPVLHTSNLPSYTPTINMPNTSVVLDTDAEFVSDSS
SSSSSSSSSSSSGPPLPLPSVSQSHHLFSSILPSTRASVHLLKSTSDASTPWSSSPSPLP
VSLTTSTSAPLSVSQTTLPQSSSTPVLPRARETPVTSVQTSTMTSFMTMLHSSQTADLKN
QSTPHQEKVITESKSPSLVSLPTESTKAVTTNSPLPPSLTESSTEQTLPATSTNLAQMSP
TFTTTILKTSQPLMTTPGTLSSTASLVTGPIAVQTTAGKQLSLTHPEILVPQISTEGGIS
TERNRVIVDATTGLIPLTSVPTSAKEMTTKLGVTAEYSPASRSLGTSPSPQTTVVSTAED
LAPKSATFAVQSSTQSPTTLSSSASVNSCAVNPCLHDGECIADNTSRGYHCRCPPSWQGD
DCSVDVNECLSNPCPSTATCNNTQGSFICRCPVGYQLEKGICNLVRTFVTEFKLKRTFLN
TTVEKHSDLQEVENEITKTLNMCFSALPSYIQSTVHASRESNAVVISLQTTFSLASNVTL
FDLADRMQKCVNSCKSSAEVCQLLGSQRRIFRAGSLCKRKSPECDKDTSICTDLDGVALC
QCKSGYFQFNKMDHSCRACEDGYRLENETCMSCPFGLGGLNCGNPYQLITVVIAAAGGGL
LLILGIALIVTCCRKNKNDISKLIFKSGDFQMSPYAEYPKNPRSQEWGREAIEMHENGST
KNLLQMTDVYYSPTSVRNPELERNGLYPAYTGLPGSRHSCIFPGQYNPSFISDESRRRDY
F
Download sequence
Identical sequences 9598.ENSPTRP00000026403 ENSPTRP00000026403 ENSPTRP00000026403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]