SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026594 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026594
Domain Number 1 Region: 264-364
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-27
Family SH2 domain 0.00034
Further Details:      
 
Domain Number 2 Region: 188-290
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-22
Family SH3-domain 0.000076
Further Details:      
 
Domain Number 3 Region: 111-167
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 4 Region: 5-61
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026594   Gene: ENSPTRG00000015434   Transcript: ENSPTRT00000028816
Sequence length 377
Comment pep:known chromosome:CHIMP2.1.4:3:140384962:140472650:1 gene:ENSPTRG00000015434 transcript:ENSPTRT00000028816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
Download sequence
Identical sequences A0A0D9REU4 A0A0S2Z4Y3 A0A2K5LJI1 A0A2K5Y191 A0A2K6CMA1 A0A2K6RPL8 F7E0A3 G1QVI6 G2HHN0 G3SC98 G7NXX3 P16333
ENSNLEP00000004957 ENSMMUP00000009696 gi|5453754|ref|NP_006144.1| ENSPTRP00000026594 ENSP00000288986 ENSP00000288986 ENSP00000417273 ENSMMUP00000009696 NP_001233509.1.37143 NP_001244409.1.72884 NP_001278928.1.87134 NP_001278928.1.92137 NP_006144.1.87134 NP_006144.1.92137 XP_003265314.1.23891 XP_003822536.1.60992 XP_004037760.1.27298 XP_005545915.1.63531 XP_005545916.1.63531 XP_005545917.1.63531 XP_008007212.1.81039 XP_008007213.1.81039 XP_008007214.1.81039 XP_008007215.1.81039 XP_008974314.1.60992 XP_008974315.1.60992 XP_008974317.1.60992 XP_009444752.1.37143 XP_009444753.1.37143 XP_010363118.1.97406 XP_010363119.1.97406 XP_011719829.1.29376 XP_011719830.1.29376 XP_011719831.1.29376 XP_011719832.1.29376 XP_011835709.1.47321 XP_011835713.1.47321 XP_011916784.1.92194 XP_011916785.1.92194 XP_011916786.1.92194 XP_011916787.1.92194 XP_011916788.1.92194 XP_012364066.1.23891 XP_012364067.1.23891 XP_014987536.1.72884 XP_014987537.1.72884 XP_014987538.1.72884 XP_015300611.1.63531 XP_015300612.1.63531 XP_018880324.1.27298 ENSPTRP00000026594 ENSP00000288986 ENSP00000417273 ENSNLEP00000004957 HR4644 9544.ENSMMUP00000009696 9598.ENSPTRP00000026594 9606.ENSP00000288986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]