SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026793 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026793
Domain Number 1 Region: 180-376
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-34
Family Pentraxin (pentaxin) 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026793   Gene: ENSPTRG00000015565   Transcript: ENSPTRT00000029035
Sequence length 381
Comment pep:known chromosome:CHIMP2.1.4:3:161174794:161181669:1 gene:ENSPTRG00000015565 transcript:ENSPTRT00000029035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLQPTEDPTPCDCGQEHSEWDKLF
IMLENSQMREGMLLQATEDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL
LEATRDAGRRLARLEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCE
TAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYL
SYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGH
IVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETRGAESCHIR
GNIVGWGVTEIQPHGGAQYVS
Download sequence
Identical sequences H2QNM9
9598.ENSPTRP00000026793 ENSPTRP00000026793 ENSPTRP00000026793 XP_516838.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]