SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026857 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026857
Domain Number 1 Region: 28-379
Classification Level Classification E-value
Superfamily L domain-like 7.65e-62
Family Internalin LRR domain 0.028
Further Details:      
 
Domain Number 2 Region: 324-488
Classification Level Classification E-value
Superfamily RNI-like 3.53e-25
Family Rna1p (RanGAP1), N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026857   Gene: ENSPTRG00000015607   Transcript: ENSPTRT00000029104
Sequence length 560
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:173646057:173661895:1 gene:ENSPTRG00000015607 transcript:ENSPTRT00000029104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDIKSVEHSPKIHQRNDPQHVNDRTFFIDASNQSLTAIPLEIFTFTELEEVHLENNQI
EEIPQEIQRLKNIRVLYLDKNNLRSLCPALGLLSSLESLDLSYNPIFSSSLVVVSFLHAL
RELRLYQTDLKEIPVVICKNLHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQFEVF
PQELCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFYMASNNLPVLPASLCQCSQLSVLD
LSHNLLHSIPKSLAELRKMTEIGLSGNRLEKVPRLICRWTSLHLLYLGNTGLHRLRGSFR
CLVNLRFLDLSQNHLDHCPLQICALKNLEVLGLDDNKIGQLPSELGSLSKLKILGLTGNE
FLSFPEEVLSLASLEKLYIGQDQGFKLTYVPEHIRKLQSLKELYIENNHLEYLPVSLGSM
PNLEVLDCRHNLLKQLPDAICQAQALKELRLEDNLLTHLPENLDSLVNLKVLTLMDNPME
EPPKEVCAEGNEAIWKYLKENRNRNIMATKIQAWWRGTMVQRGFGKFGELLKPQKKGKTS
PKDKKGKKDVKGKPGKGKKK
Download sequence
Identical sequences H2QNQ1
ENSPTRP00000026857 XP_016797769.1.37143 ENSPTRP00000026857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]