SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027006 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027006
Domain Number 1 Region: 703-764
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000126
Family VWC domain 0.0043
Further Details:      
 
Domain Number 2 Region: 49-127
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000178
Family VWC domain 0.02
Further Details:      
 
Domain Number 3 Region: 782-851
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000418
Family VWC domain 0.06
Further Details:      
 
Domain Number 4 Region: 870-933
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000262
Family VWC domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027006   Gene: ENSPTRG00000015695   Transcript: ENSPTRT00000029261
Sequence length 937
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:188419171:188427898:1 gene:ENSPTRG00000015695 transcript:ENSPTRT00000029261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLPAPPAPLLLLGLLLLGSRPARGAGPEPPVLPIRSEKEPLPVRGAAGCSFGGKVYAL
DETWHPDLGEPFGVMRCVLCACEAPQWGRRTRGPGRVSCKNIKPECPTPACGQPRQLPGH
CCQTCPQERSSSERQPSGLSFEYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPR
SQAVARARVSLLRSSLRFSISYRRLDRPTRVRFSDSNGSVLFEHPAAPTQDGLVCGVWRA
VPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGVGGI
TLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFA
EVLPNLTVQEMDWLVLGELQMALELAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQ
TGAAGSASLTLLGNGSLIYQVQVVGTSSEVVAMTLETKPQRRDQRTVLCHMAGLQPGGHT
AVGICPGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVAALPYCGHSARHDTLPVPLAG
ALVLPPVKSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLK
GFYGSEAQGVVKDLEPELLRHLAKGMASLLITTKGSPRGELRGQVHIANQCEVGGLRLEA
AGAEGVRALGAPDTAAAAPPVVRGLPALAPAKPGGPGRPRDPNTCFFEGQQRPHGARWAP
NYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRDLPGLPRSRDP
GEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLACAQPVR
VNPTDCCKQCPVGSGAHPQLGDPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITC
RCGAGVPHCERDDCSLPLSCGSGKESRCCSRCTAHRR
Download sequence
Identical sequences ENSPTRP00000027006 9598.ENSPTRP00000027006 ENSPTRP00000027006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]