SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027103 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027103
Domain Number 1 Region: 138-470
Classification Level Classification E-value
Superfamily L domain-like 3.49e-65
Family Internalin LRR domain 0.015
Further Details:      
 
Domain Number 2 Region: 32-195
Classification Level Classification E-value
Superfamily L domain-like 3.49e-31
Family Ngr ectodomain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027103   Gene: ENSPTRG00000015755   Transcript: ENSPTRT00000029361
Sequence length 587
Comment pep:known chromosome:CHIMP2.1.4:3:198490063:198495934:-1 gene:ENSPTRG00000015755 transcript:ENSPTRT00000029361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLDKAMPLKHYLLLLVGCQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTPLPWN
AMSLQILNTHITELNESPFLNISALIALRIEKNELSRIMPGAFRNLGSLRYLSLSNNKLQ
VLPIGLFQGLDSLESLLLSSNQLVQIQPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVG
LTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQIG
LLSPGLFHNNHNLQRLYLSNNHISQLPPSIFMQLPQLNRLTLFGNSLKELSPGIFGPMPN
LRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHTNALQ
DLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGK
LCELRLYDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNIAVP
SVHVPEVPSYPETPWYPDTPSYSDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVWGMTQ
AQSGLAIAAIVIGIVALACSLAACIGCCCCKKRSQAVLMQMKAPNEC
Download sequence
Identical sequences K6ZNN6
ENSPTRP00000027103 ENSPTRP00000027103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]