SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027104 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027104
Domain Number 1 Region: 120-462
Classification Level Classification E-value
Superfamily L domain-like 4.68e-59
Family Ngr ectodomain-like 0.0092
Further Details:      
 
Domain Number 2 Region: 47-159
Classification Level Classification E-value
Superfamily L domain-like 7.14e-21
Family Ngr ectodomain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027104   Gene: ENSPTRG00000015756   Transcript: ENSPTRT00000029362
Sequence length 560
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:198527034:198531487:-1 gene:ENSPTRG00000015756 transcript:ENSPTRT00000029362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGTLLCAVLGLLRAQPFPCPPACKCVFRDAAQCSGGDVARISALGLPTNLTHILLFGM
GRGVLQSHSFSGMTVLQRLMISDSHISAVAPGTFNDLIKLKTLRLSRNKITHLPGALLDK
MVLLEQLFLDHNALRGIDQNMFQKLVNLQELALNQNQLDFLPASLFTNLENLKLLDLSGN
NLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGPLNSLGALTELQFHRNHIRSIAPGAFDR
LPNLSSLTLSRNHLAFLPSALFLHSHNLTLLTLFENPLAELPGVLFGEMGGLQELWLNRT
QLRTLPAAAFRNLSRLRSLGVTLSPRLSALPQGAFQGLGELQVLALHSNGLTALPDGLLR
GLGKLRQVSLRRNRLRALPRALFRNLSSLESVQLDHNQLETLPGDVFGALPRLTEVLLGH
NSWRCDCGLGPFLGWLRQHLGLVGGEEPPRCAGPGAHAGLPLWALPGGDAECPGPRGPPP
RPAADSSSEAPVHPALAPNSSEPWVWAQPVTTGKGEDHSPFWGFYFLLLAVQAMITVIIV
FAMIKIGQLFRKLIRERALG
Download sequence
Identical sequences A0A2I3S1G1
ENSPTRP00000027104 ENSPTRP00000027104 XP_016798006.1.37143 9598.ENSPTRP00000027104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]