SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027160 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027160
Domain Number 1 Region: 4-177
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-53
Family SPRY domain 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027160   Gene: ENSPTRG00000015783   Transcript: ENSPTRT00000029429
Sequence length 180
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:200593601:200612553:1 gene:ENSPTRG00000015783 transcript:ENSPTRT00000029429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLG
TVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQI
GERIRVILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences 9598.ENSPTRP00000027160 ENSPTRP00000027160 ENSPTRP00000027160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]