SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027433 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027433
Domain Number 1 Region: 326-425,584-680
Classification Level Classification E-value
Superfamily RNI-like 2.17e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.043
Further Details:      
 
Domain Number 2 Region: 200-293
Classification Level Classification E-value
Superfamily F-box domain 2.62e-18
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027433   Gene: ENSPTRG00000015927   Transcript: ENSPTRT00000029732
Sequence length 691
Comment pep:known chromosome:CHIMP2.1.4:4:15451695:15509563:-1 gene:ENSPTRG00000015927 transcript:ENSPTRT00000029732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQI
ENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFT
RDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNHAEER
QKFFKYSVDEKSDKEAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSMKWSQLTK
TGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVKNRKDESRAFHEWDEDADIDESEES
AEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLEH
LDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLK
TSTSKITSTTWKNKDITMQSTKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVW
MLDAEDLADIEDTVEWRHRNVESLCVMETASNFSCSTSGCFSKDIVGLRTSVCWQQHCAS
PAFAYCGHSFCCTGTALRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVL
LFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFY
YCDNINGPHADTASGCQNLQCGFRACCRSGE
Download sequence
Identical sequences H2QP88
XP_517113.3.37143 ENSPTRP00000027433 9598.ENSPTRP00000027433 ENSPTRP00000027433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]