SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027487 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027487
Domain Number 1 Region: 620-861
Classification Level Classification E-value
Superfamily HCP-like 7.94e-32
Family HCP-like 0.0013
Further Details:      
 
Domain Number 2 Region: 833-948
Classification Level Classification E-value
Superfamily HCP-like 0.000000000119
Family HCP-like 0.01
Further Details:      
 
Domain Number 3 Region: 231-374
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000538
Family Laminin G-like module 0.062
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000027487
Domain Number - Region: 515-588
Classification Level Classification E-value
Superfamily HCP-like 0.000955
Family HCP-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027487   Gene: ENSPTRG00000015966   Transcript: ENSPTRT00000029790
Sequence length 1080
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:25703516:25808918:-1 gene:ENSPTRG00000015966 transcript:ENSPTRT00000029790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQNVVPSLGRQTSLTTSVIPKAEQSVAYKDFIYFTVFEGNVRNVSEVSVEYLCSQPCVVN
LEAVVSSEFRSSIPVYKKRWKNEKHLHTSRTQIVHVKFPSIMVYRDDYFIRHSISVSAVI
VRAWITHKYSGRDWNVKWEENLLHAVAKNYTLLQTIPPFERPFKDHQVCLEWNMGYIWNL
RANRIPQCPLENDVVALLGFPYASSGENTGIVKKFPRFRNRELEATRRQRMDYPVFTVSL
WLYLLHYCKANLCGILYFVDSNEMYGTPSVFLTEEGYLHIQMHLVKGEDLAVKTKFIIPL
KEWFRLDISFNGGQIVVTTSIGQDLKSYHNQTISFREDFHYNDTAGYFIIGGSRYVAGIE
GFFGPLKYYRLRSLHPAQIFNPLREKQLAEQIKLYYERCAEVQEIVSAYASAAKHGGERQ
EACHLHNSYLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSE
IGGKIFEKAVKRLSSVDGLHQISSIVPFLMDSSCCGYHKASYYLAVFYETGLNVPRDQLQ
GMLYSLVGGQGSERLSSMNLGYKHYQGIDNYPLDWELSYAYYSNIATKTPLDQHTLQGDQ
AYVETIRLKDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEA
AIEWYAKGALETEDPALIYDYAIVLFKGQGVKKNRRLALELMKKAASKGLHQAVNGLGWY
YHKFKKNYAKAAKYWLKAEEMGNPDASYNLGVLHLDGIFPGVPGRNQTLAGEYFHKAAQG
GHMEGTLWCSLYYITGNLETFPRDPEKAVVWAKHVAEKNGYLGHVIRKGLNAYLEGSWHE
ALLYYVLAAETGIEVSQTNLAHICEERPDLARRYLGVNCVWRYYNFSVFQIDAPSFAYLK
MGDLYYYGHQNQSQDLELSVQMYAQAALDGDSQGFFNLALLIEEGTIIPHHILDFLEIDS
TLHSNNISILQELYERCWSHSNEESFSPCSLAWLYLHLRLLWGAILHSALIYFLGTFLLS
ILIAWTVQYFQSVSASDPPPRPSQASPDTATSTASPAVTPAADASDQDQPTVTNNPEPRG
Download sequence
Identical sequences ENSPTRP00000027487 ENSPTRP00000027487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]