SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027516 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027516
Domain Number 1 Region: 630-778
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.92e-47
Family Toll/Interleukin receptor TIR domain 0.0000000402
Further Details:      
 
Domain Number 2 Region: 30-164,353-540
Classification Level Classification E-value
Superfamily L domain-like 3.16e-40
Family Leucine rich effector protein YopM 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027516   Gene: ENSPTRG00000015985   Transcript: ENSPTRT00000029821
Sequence length 786
Comment pep:known chromosome:CHIMP2.1.4:4:38809866:38818312:-1 gene:ENSPTRG00000015985 transcript:ENSPTRT00000029821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISEL
WTSDILSLSKLRILIISHNRIQYLDISVFKFNHELEYLDLSHNKLVKISCHPTVNLKHLD
LSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKILLVLGETYGEKED
PEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL
QTNPKLSSLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLK
ALSIHQVVSDVFSFPQSDIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLL
TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSL
TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREFVKNID
QVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSL
CIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE
KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH
EGSNNLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLKAAINIKL
TEQAKK
Download sequence
Identical sequences B3Y606 D7NVE9 S5Q4Q0
9598.ENSPTRP00000027516 ENSPTRP00000027516 ENSPTRP00000027516 NP_001123937.1.37143 XP_009445756.1.37143 XP_009445758.1.37143 XP_009445759.1.37143 XP_016806459.1.37143 XP_016806460.1.37143 XP_016806461.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]