SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027614 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027614
Domain Number 1 Region: 34-265
Classification Level Classification E-value
Superfamily L domain-like 5.5e-34
Family Ngr ectodomain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027614   Gene: ENSPTRG00000016052   Transcript: ENSPTRT00000029924
Sequence length 880
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:78032287:78056206:1 gene:ENSPTRG00000016052 transcript:ENSPTRT00000029924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNLYFRVITIVIGLYFTGIMTNASRKSNILFNSECQWNEYILTNCSFTGKCDIPVDISQ
TAATVDVSFNFFRVLLQSHTKKEEWKIKHLDLSNNLISKITLSPFAYLHALEVLNLSNNA
IHSLSLDLLSPKSSWVKRHRSSFRNRFPLLKVLILQRNKLSDTPKGLWKLKSLQSLDLSF
NGILQIGWSDFHNCLQLENLCLKSNKIFKIHPQAFKDLKKLQVIDLSNNALTTILPMMII
ALEFPHLVVDLADNNWQCDDSVAIFQNFISESWRKKWNVICNRSIGSEEANGGTPQSRIS
RETRLPPIHLHRMKSLIRSKAERPQGGRHTGISTLGKKAKAGSGLRKKQRRLPRSVRSTR
DVQAAGKKEDAPQDLALAVCLSVFITFLVAFSLGAFTRPYVDRLWQKKCQNKSPGLDNAY
SNEGFYDDMEAAGHTPHPETHLRQAFPHLSLYENQTPFWVTQSHPHATVIPDRTLGRSRK
DPGSSQSPGQCGDNTGAGSGNDGAVYSILQRHPHAGNRELMSAAQDHIHRNDVLGEWTYE
TVAQEEPLSAHSVGVSSVAGTSHAVSGSSRYDSNELDPSLSGEITASLCKMLTHAEAQRT
GDSKERGGTEQSLWDSQMEFSKERQVSSSIDLLSIQQPRLSGARAEEALSAHYSEVPYGD
PRDTGPSVFPPRWDSGLDVTPANKESVQKSTPSDICCELESDCDSDEGSLFTLSSISSES
ARSKTEEAVPDEESLQDESSGASKDNVTAVDSLEENVTFQTITGKCKNQEDPFEKPLISA
PDSGMYKTHLENASDTDRSEGLSPWPRSPGNSPLGDEFPGMFTYDYDTALQSKAAEWHCS
LRDLEFSNVDVLQQTPPCSAEVPSDPDKAAFHERDSDILK
Download sequence
Identical sequences H2QPG3
XP_517300.1.37143 ENSPTRP00000027614 9598.ENSPTRP00000027614 ENSPTRP00000027614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]