SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027683 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027683
Domain Number 1 Region: 669-949
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-83
Family Protein kinases, catalytic subunit 0.000000000777
Further Details:      
 
Domain Number 2 Region: 60-232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-71
Family Ephrin receptor ligand binding domain 0.00000132
Further Details:      
 
Domain Number 3 Region: 357-560
Classification Level Classification E-value
Superfamily Fibronectin type III 2.84e-40
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 965-1032
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.45e-21
Family SAM (sterile alpha motif) domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000027683
Domain Number - Region: 288-349,395-400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000275
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027683   Gene: ENSPTRG00000016095   Transcript: ENSPTRT00000029995
Sequence length 1037
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:64278250:64630900:1 gene:ENSPTRG00000016095 transcript:ENSPTRT00000029995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNE
VNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISN
EGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAAD
ESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHL
AVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG
TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSA
PRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGTRQYVSVNVTTNQAAPSPVTNVKKGKI
AKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQI
RARTAAGYGVFSRRFEFETTPVFAASSDQSQIPIIAVSVTVGVILLAVVIGVLLSGSCCE
CGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPN
QAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRD
FLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGM
LRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSP
MDCPAALYQLMLDCWQKDRNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHS
PLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIM
NSLQEMKVQLVNGMVPL
Download sequence
Identical sequences A0A2J8PEX5
XP_001165182.1.37143 9598.ENSPTRP00000027683 ENSPTRP00000027683 ENSPTRP00000027683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]