SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027782 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027782
Domain Number 1 Region: 47-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000133
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027782   Gene: ENSPTRG00000016165   Transcript: ENSPTRT00000030097
Sequence length 145
Comment pep:known chromosome:CHIMP2.1.4:4:55758378:55765211:-1 gene:ENSPTRG00000016165 transcript:ENSPTRT00000030097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCI
NGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIF
YCYIRKRCLKLKSPYNVCSGERRPL
Download sequence
Identical sequences ENSPTRP00000027782 ENSPTRP00000027782 XP_011530119.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]